PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC4664_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family HB-other
Protein Properties Length: 332aa    MW: 37254.8 Da    PI: 5.0103
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC4664_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.71.5e-21115170156
                 TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 +++ +++t+ q++e+e+lF++n++p+ ++r++L+++lgL+ rqVk+WFqNrR+++k
  RrC4664_p1 115 KKRYHRHTDRQIQEMEALFKENPHPDDKQRQRLSHELGLKPRQVKFWFQNRRTQMK 170
                 688999***********************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.15E-21104173IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.2E-23109178IPR009057Homeodomain-like
PROSITE profilePS5007117.799112172IPR001356Homeobox domain
SMARTSM003892.1E-19113176IPR001356Homeobox domain
PfamPF000464.8E-19115170IPR001356Homeobox domain
CDDcd000861.26E-19115173No hitNo description
PROSITE patternPS000270147170IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MLTIGEGSVL TSDNIFASPP PPASSSPATI QNSNFNFIPF NSFSSIIPKE EHGMMSMSMS  60
MMMMMGDETV EEMMDNGSVG GSFGSGSEQP EDPKSGNEFD VNELRDDGQP PPAKKKRYHR  120
HTDRQIQEME ALFKENPHPD DKQRQRLSHE LGLKPRQVKF WFQNRRTQMK AQQDRAENVM  180
LRADNDNLKL ENSQLQAELQ CLSCPSCGGP TVLGDIPFNE LHIENCRLRE ELDRLCCIAS  240
RYTDRPMQSM PSSQPLINPA SALPHHQPSL ELDMSAYAGN FPEHPCPDLT SLPPQDTACF  300
FPNQTNNNSN KNNMLLADEE KVIAKSRDKA RG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892454e-67AC189245.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB017K02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013607211.10.0PREDICTED: homeobox-leucine zipper protein HDG5
RefseqXP_013607210.10.0PREDICTED: homeobox-leucine zipper protein HDG5
RefseqXP_013607209.10.0PREDICTED: homeobox-leucine zipper protein HDG5
SwissprotQ9FJS21e-171HDG5_ARATH; Homeobox-leucine zipper protein HDG5
TrEMBLA0A0D3E7100.0A0A0D3E710_BRAOL; Uncharacterized protein
STRINGBra017519.1-P1e-170(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49128149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.11e-150homeobox-7